PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN38480.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family TALE
Protein Properties Length: 316aa    MW: 36312.1 Da    PI: 6.7872
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN38480.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox31.33.5e-102462802155
                 HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
    Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                 k +yps+++++ LA+++gL+ +q+ +WF N+R ++
  KHN38480.1 246 KWPYPSESQKQALAESTGLDMKQINNWFINQRKRH 280
                 569*****************************885 PP

2ELK38.42.6e-13200221122
         ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                 ELK qLlrKYsgyLgsLk+EF+
  KHN38480.1 200 ELKVQLLRKYSGYLGSLKKEFL 221
                 9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012551.8E-1466110IPR005540KNOX1
PfamPF037905.3E-1868106IPR005540KNOX1
SMARTSM012562.2E-26119170IPR005541KNOX2
PfamPF037916.6E-22122168IPR005541KNOX2
PROSITE profilePS5121311.139200220IPR005539ELK domain
PfamPF037891.9E-9200221IPR005539ELK domain
SMARTSM011887.1E-7200221IPR005539ELK domain
PROSITE profilePS5007112.293220283IPR001356Homeobox domain
SuperFamilySSF466891.67E-19222294IPR009057Homeodomain-like
SMARTSM003892.4E-12222287IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.4E-28225286IPR009057Homeodomain-like
CDDcd000861.48E-12232284No hitNo description
PfamPF059201.6E-17240279IPR008422Homeobox KN domain
PROSITE patternPS000270258281IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 316 aa     Download sequence    Send to blast
MIGFGGNSCS ELSEMDMTNM ETNRKFLSLP LSNNNNSGDN RRVPVTSNSI AQEHHYSHHH  60
NPTDTCSVRD KIMAHPLFPR LLSSYLNCLK VGAPPEVVAS LEESYAKYES FNASSGRIGG  120
GSIGEDPALD QFMEAYCEML IKYEQELTKP FKEAMLFFSR IECQLKALAV SSDFGQSETS  180
SKNEVDVHEN NLDSQAEDRE LKVQLLRKYS GYLGSLKKEF LKKKKNGKLP KEARQQLLDW  240
WNRHYKWPYP SESQKQALAE STGLDMKQIN NWFINQRKRH WKPSEDMQFA VMDATNYYME  300
NVMCKPFPMD SMPMLL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014502681.10.0PREDICTED: homeobox protein SBH1-like isoform X1
SwissprotP466081e-118HSBH1_SOYBN; Homeobox protein SBH1
TrEMBLA0A0B2RZR30.0A0A0B2RZR3_GLYSO; Homeobox protein SBH1
STRINGGLYMA14G05150.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20393480
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62360.11e-102KNOX/ELK homeobox transcription factor
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]